PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03583.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 254aa    MW: 27456.4 Da    PI: 6.2417
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03583.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.41.3e-071612031557
                                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   ++A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a
  Zpz_sc03583.1.g00050.1.am.mk 161 ISAARSKERKMRYIAELEQKVQILQTEATTLSAQLTLLQRDSA 203
                                   69********************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.9E-5155211IPR004827Basic-leucine zipper domain
CDDcd147031.78E-17161203No hitNo description
SuperFamilySSF579591.45E-6161201No hitNo description
Gene3DG3DSA:1.20.5.1703.4E-7161203No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDVEHAARKA AAHRRSRSDV PLGYFPPPKV EAGLGGHHDA DDLFTAFLNL EGLDGLHNSS  60
DERHDDGDRD SRGSSMKMTN GADSSENESE EGAAADRRPA GVRLWATDAI NRLEGLNLKR  120
SAAGEPSAAP MVRHARSLSV DSLIGKFNFS AGGTTSATSG ISAARSKERK MRYIAELEQK  180
VQILQTEATT LSAQLTLLQR DSAGIATQNN ELKFRLQAME QQAQLRDGNI PRAEVVDADM  240
LACPSSWVHV HLTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715093e-73EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468594.14e-90hypothetical protein SORBIDRAFT_01g048710
TrEMBLA0A0A9D7S71e-95A0A0A9D7S7_ARUDO; Uncharacterized protein
STRINGSb01g048710.11e-89(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.28e-20bZIP family protein